Cytochrome c oxidase subunit 7B2, mitochondrial

NameCytochrome c oxidase subunit 7B2, mitochondrial
Synonyms
  • Cytochrome c oxidase polypeptide VIIb2
Gene NameCOX7B2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008758|Cytochrome c oxidase subunit 7B2, mitochondrial
MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ
IGIEWNLSPVGRVTPKEWKHQ
Number of residues81
Molecular Weight9077.43
Theoretical pINot Available
GO Classification
Functions
  • cytochrome-c oxidase activity
Processes
  • hydrogen ion transmembrane transport
Components
  • mitochondrial respiratory chain
  • mitochondrion
  • integral component of membrane
  • respiratory chain complex IV
General FunctionCytochrome-c oxidase activity
Specific FunctionThis protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Pfam Domain Function
Transmembrane Regions34-60
GenBank Protein IDNot Available
UniProtKB IDQ8TF08
UniProtKB Entry NameCX7B2_HUMAN
Cellular LocationMitochondrion inner membrane
Gene sequence
>lcl|BSEQ0013398|Cytochrome c oxidase subunit 7B2, mitochondrial (COX7B2)
ATGATGTTTCCCTTGGCCAGAAATGCACTAAGCAGTCTCAAGATTCAAAGCATTCTGCAA
AGCATGGCAAGACATAGCCATGTAAAACACTCACCAGATTTTCATGATAAATATGGTAAT
GCTGTGCTAGCCAGTGGAACTGCTTTCTGTGTTGCTACATGGGTGTTTACAGCCACTCAG
ATTGGAATAGAATGGAACCTATCCCCTGTTGGCAGAGTTACCCCAAAAGAGTGGAAACAT
CAGTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:24381
Chromosome Location4
LocusNot Available
References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  2. Liang H, Chen H, Shen Y, Feng Q, Jin W, Huang W, Zeng Y: A rare polymorphism of the COX7B2 gene in a Cantonese family with nasopharyngeal carcinoma. Sci China C Life Sci. 2004 Oct;47(5):449-53. 15623157