NameTroponin C, slow skeletal and cardiac muscles
Synonyms
  • TN-C
  • TNNC
Gene NameTNNC1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0016288|Troponin C, slow skeletal and cardiac muscles
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIM
LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Number of residues161
Molecular Weight18402.36
Theoretical pI3.78
GO Classification
Functions
  • calcium-dependent protein binding
  • actin filament binding
  • troponin I binding
  • calcium ion binding
  • troponin T binding
  • protein homodimerization activity
Processes
  • cardiac muscle contraction
  • ventricular cardiac muscle tissue morphogenesis
  • diaphragm contraction
  • response to metal ion
  • muscle filament sliding
  • regulation of muscle contraction
  • regulation of ATPase activity
  • regulation of muscle filament sliding speed
  • transition between fast and slow fiber
Components
  • nucleoplasm
  • troponin complex
  • mitochondrion
  • actin cytoskeleton
  • cytosol
General FunctionTroponin t binding
Specific FunctionTroponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID37208
UniProtKB IDP63316
UniProtKB Entry NameTNNC1_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0016289|Troponin C, slow skeletal and cardiac muscles (TNNC1)
ATGGATGACATCTACAAGGCTGCGGTAGAGCAGCTGACAGAAGAGCAGAAAAATGAGTTC
AAGGCAGCCTTCGACATCTTCGTGCTGGGCGCTGAGGATGGCTGCATCAGCACCAAGGAG
CTGGGCAAGGTGATGAGGATGCTGGGCCAGAACCCCACCCCTGAGGAGCTGCAGGAGATG
ATCGATGAGGTGGACGAGGACGGCAGCGGCACGGTGGACTTTGATGAGTTCCTGGTCATG
ATGGTTCGGTGCATGAAGGACGACAGCAAAGGGAAATCTGAGGAGGAGCTGTCTGACCTC
TTCCGCATGTTTGACAAAAATGCTGATGGCTACATCGACCTGGATGAGCTGAAGATAATG
CTGCAGGCTACAGGCGAGACCATCACGGAGGACGACATCGAGGAGCTCATGAAGGACGGA
GACAAGAACAACGACGGCCGCATCGACTATGATGAGTTCCTGGAGTTCATGAAGGGTGTG
GAGTAG
GenBank Gene IDX07897
GeneCard IDNot Available
GenAtlas IDTNNC1
HGNC IDHGNC:11943
Chromosome Location3
Locus3p21.3-p14.3
References
  1. Roher A, Lieska N, Spitz W: The amino acid sequence of human cardiac troponin-C. Muscle Nerve. 1986 Jan;9(1):73-7. 3951483
  2. Gahlmann R, Wade R, Gunning P, Kedes L: Differential expression of slow and fast skeletal muscle troponin C. Slow skeletal muscle troponin C is expressed in human fibroblasts. J Mol Biol. 1988 May 20;201(2):379-91. 3166492
  3. Schreier T, Kedes L, Gahlmann R: Cloning, structural analysis, and expression of the human slow twitch skeletal muscle/cardiac troponin C gene. J Biol Chem. 1990 Dec 5;265(34):21247-53. 2250022
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Spyracopoulos L, Li MX, Sia SK, Gagne SM, Chandra M, Solaro RJ, Sykes BD: Calcium-induced structural transition in the regulatory domain of human cardiac troponin C. Biochemistry. 1997 Oct 7;36(40):12138-46. 9315850
  6. Takeda S, Kobayashi T, Taniguchi H, Hayashi H, Maeda Y: Structural and functional domains of the troponin complex revealed by limited digestion. Eur J Biochem. 1997 Jun 15;246(3):611-7. 9219516
  7. Lindhout DA, Sykes BD: Structure and dynamics of the C-domain of human cardiac troponin C in complex with the inhibitory region of human cardiac troponin I. J Biol Chem. 2003 Jul 18;278(29):27024-34. Epub 2003 May 5. 12732641
  8. Hoffmann B, Schmidt-Traub H, Perrot A, Osterziel KJ, Gessner R: First mutation in cardiac troponin C, L29Q, in a patient with hypertrophic cardiomyopathy. Hum Mutat. 2001 Jun;17(6):524. 11385718
  9. Mogensen J, Murphy RT, Shaw T, Bahl A, Redwood C, Watkins H, Burke M, Elliott PM, McKenna WJ: Severe disease expression of cardiac troponin C and T mutations in patients with idiopathic dilated cardiomyopathy. J Am Coll Cardiol. 2004 Nov 16;44(10):2033-40. 15542288
  10. Schmidtmann A, Lindow C, Villard S, Heuser A, Mugge A, Gessner R, Granier C, Jaquet K: Cardiac troponin C-L29Q, related to hypertrophic cardiomyopathy, hinders the transduction of the protein kinase A dependent phosphorylation signal from cardiac troponin I to C. FEBS J. 2005 Dec;272(23):6087-97. 16302972
  11. Landstrom AP, Parvatiyar MS, Pinto JR, Marquardt ML, Bos JM, Tester DJ, Ommen SR, Potter JD, Ackerman MJ: Molecular and functional characterization of novel hypertrophic cardiomyopathy susceptibility mutations in TNNC1-encoded troponin C. J Mol Cell Cardiol. 2008 Aug;45(2):281-8. doi: 10.1016/j.yjmcc.2008.05.003. Epub 2008 May 11. 18572189
  12. Pinto JR, Parvatiyar MS, Jones MA, Liang J, Ackerman MJ, Potter JD: A functional and structural study of troponin C mutations related to hypertrophic cardiomyopathy. J Biol Chem. 2009 Jul 10;284(28):19090-100. doi: 10.1074/jbc.M109.007021. Epub 2009 May 12. 19439414