NameVesicle-associated membrane protein 2
Synonyms
  • SYB2
  • Synaptobrevin-2
  • VAMP-2
Gene NameVAMP2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0016692|Vesicle-associated membrane protein 2
MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKL
SELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Number of residues116
Molecular Weight12662.585
Theoretical pI8.48
GO Classification
Functions
  • calcium-dependent protein binding
  • calmodulin binding
  • syntaxin-1 binding
  • protein self-association
  • SNARE binding
  • syntaxin binding
  • phospholipid binding
  • SNAP receptor activity
Processes
  • cellular protein metabolic process
  • long-term synaptic potentiation
  • membrane organization
  • eosinophil degranulation
  • regulation of delayed rectifier potassium channel activity
  • energy reserve metabolic process
  • vesicle-mediated transport
  • regulation of vesicle-mediated transport
  • regulation of insulin secretion
  • vesicle fusion
  • protein complex assembly
  • synaptic vesicle exocytosis
  • positive regulation of intracellular protein transport
  • glutamate secretion
  • neurotransmitter secretion
  • exocytosis
  • cellular response to insulin stimulus
  • small molecule metabolic process
  • regulation of exocytosis
  • Golgi to plasma membrane protein transport
  • protein transport
  • response to glucose
  • post-Golgi vesicle-mediated transport
  • membrane fusion
  • calcium ion-dependent exocytosis
  • synaptic transmission
Components
  • synaptobrevin 2-SNAP-25-syntaxin-1a-complexin II complex
  • vesicle
  • intracellular membrane-bounded organelle
  • zymogen granule membrane
  • cytoplasmic vesicle
  • clathrin-coated vesicle
  • synapse
  • synaptic vesicle
  • secretory granule membrane
  • trans-Golgi network
  • cell junction
  • neuron projection
  • clathrin-sculpted monoamine transport vesicle membrane
  • cytosol
  • membrane
  • extracellular exosome
  • terminal bouton
  • perinuclear region of cytoplasm
  • neuron projection terminus
  • clathrin-sculpted glutamate transport vesicle membrane
  • plasma membrane
  • storage vacuole
  • synaptic vesicle membrane
  • integral component of plasma membrane
  • SNARE complex
  • synaptobrevin 2-SNAP-25-syntaxin-1a complex
  • secretory granule
  • synaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complex
  • clathrin-sculpted gamma-aminobutyric acid transport vesicle membrane
General FunctionSyntaxin-1 binding
Specific FunctionInvolved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
Pfam Domain Function
Transmembrane Regions95-114
GenBank Protein ID338632
UniProtKB IDP63027
UniProtKB Entry NameVAMP2_HUMAN
Cellular LocationCytoplasmic vesicle
Gene sequence
>lcl|BSEQ0016693|Vesicle-associated membrane protein 2 (VAMP2)
ATGTCTGCTACCGCTGCCACGGCCCCCCCTGCTGCCCCGGCTGGGGAGGGTGGTCCCCCT
GCACCCCCTCCAAACCTCACCAGTAACAGGAGACTGCAGCAGACCCAGGCCCAGGTGGAT
GAGGTGGTGGACATCATGAGGGTGAACGTGGACAAGGTCCTGGAGCGAGACCAGAAGCTG
TCGGAGCTGGACGACCGTGCAGATGCACTCCAGGCGGGGGCCTCCCAGTTTGAAACAAGC
GCAGCCAAGCTCAAGCGCAAATACTGGTGGAAAAACCTCAAGATGATGATCATCTTGGGA
GTGATTTGCGCCATCATCCTCATCATCATCATAGTTTACTTCAGCACTTAA
GenBank Gene IDM36205
GeneCard IDNot Available
GenAtlas IDVAMP2
HGNC IDHGNC:12643
Chromosome Location17
Locus17p13.1
References
  1. Archer BT 3rd, Ozcelik T, Jahn R, Francke U, Sudhof TC: Structures and chromosomal localizations of two human genes encoding synaptobrevins 1 and 2. J Biol Chem. 1990 Oct 5;265(28):17267-73. 1976629
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Jagadish MN, Fernandez CS, Hewish DR, Macaulay SL, Gough KH, Grusovin J, Verkuylen A, Cosgrove L, Alafaci A, Frenkel MJ, Ward CW: Insulin-responsive tissues contain the core complex protein SNAP-25 (synaptosomal-associated protein 25) A and B isoforms in addition to syntaxin 4 and synaptobrevins 1 and 2. Biochem J. 1996 Aug 1;317 ( Pt 3):945-54. 8760387
  5. Kutay U, Ahnert-Hilger G, Hartmann E, Wiedenmann B, Rapoport TA: Transport route for synaptobrevin via a novel pathway of insertion into the endoplasmic reticulum membrane. EMBO J. 1995 Jan 16;14(2):217-23. 7835332
  6. Fritzius T, Frey AD, Schweneker M, Mayer D, Moelling K: WD-repeat-propeller-FYVE protein, ProF, binds VAMP2 and protein kinase Czeta. FEBS J. 2007 Mar;274(6):1552-66. 17313651
  7. Hanson MA, Stevens RC: Cocrystal structure of synaptobrevin-II bound to botulinum neurotoxin type B at 2.0 A resolution. Nat Struct Biol. 2000 Aug;7(8):687-92. 10932255