| Name | Basic phospholipase A2 VRV-PL-VIIIa |
|---|
| Synonyms | - 3.1.1.4
- DPLA2
- P1
- Phosphatidylcholine 2-acylhydrolase
- Phospholipase A2 4
- PLA24
- svPLA2
|
|---|
| Gene Name | Not Available |
|---|
| Organism | Russel's viper |
|---|
| Amino acid sequence | >lcl|BSEQ0013597|Basic phospholipase A2 VRV-PL-VIIIa
SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCCYGNLPDCNPK
SDRYKYKRVNGAIVCEKGTSCENRICECDKAAAICFRQNLNTYSKKYMLYPDFLCKGELK
C |
|---|
| Number of residues | 121 |
|---|
| Molecular Weight | 13610.55 |
|---|
| Theoretical pI | Not Available |
|---|
| GO Classification | Functions - calcium ion binding
- phospholipase A2 activity
Processes - phospholipid metabolic process
- lipid catabolic process
Components - extracellular region
- other organism presynaptic membrane
|
|---|
| General Function | Phospholipase a2 activity |
|---|
| Specific Function | Snake venom phospholipase A2 (PLA2) that shows weak neurotoxicity and medium anticoagulant effects by binding to factor Xa (F10) and inhibiting the prothrombinase activity (IC(50) is 130 nM) (PubMed:18062812). It also damages vital organs such as lung, liver and kidney, displays edema-inducing activities when injected into the foot pads of mice and induces necrosis of muscle cells when injected into the thigh muscle. Has a low enzymatic activity. PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. |
|---|
| Pfam Domain Function | |
|---|
| Transmembrane Regions | Not Available |
|---|
| GenBank Protein ID | Not Available |
|---|
| UniProtKB ID | P59071 |
|---|
| UniProtKB Entry Name | PA2B8_DABRR |
|---|
| Cellular Location | Secreted |
|---|
| Gene sequence | Not Available |
|---|
| GenBank Gene ID | Not Available |
|---|
| GeneCard ID | Not Available |
|---|
| GenAtlas ID | Not Available |
|---|
| HGNC ID | Not Available |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | Not Available |
|---|
| References | - Gowda VT, Schmidt J, Middlebrook JL: Primary sequence determination of the most basic myonecrotic phospholipase A2 from the venom of Vipera russelli. Toxicon. 1994 Jun;32(6):665-73. 7940574
- Tsai IH, Lu PJ, Su JC: Two types of Russell's viper revealed by variation in phospholipases A2 from venom of the subspecies. Toxicon. 1996 Jan;34(1):99-109. 8835338
- Suzuki M, Itoh T, Anuruddhe BM, Bandaranayake IK, Shirani Ranasinghe JG, Athauda SB, Moriyama A: Molecular diversity in venom proteins of the Russell's viper (Daboia russellii russellii) and the Indian cobra (Naja naja) in Sri Lanka. Biomed Res. 2010 Feb;31(1):71-81. 20203422
- Kasturi S, Gowda TV: Purification and characterization of a major phospholipase A2 from Russell's viper (Vipera russelli) venom. Toxicon. 1989;27(2):229-37. 2718191
- Kasturi S, Rudrammaji LM, Gowda TV: Antibodies to a phospholipase A2 from Vipera russelli selectively neutralize venom neurotoxicity. Immunology. 1990 Jun;70(2):175-80. 2115497
- Faure G, Gowda VT, Maroun RC: Characterization of a human coagulation factor Xa-binding site on Viperidae snake venom phospholipases A2 by affinity binding studies and molecular bioinformatics. BMC Struct Biol. 2007 Dec 6;7:82. 18062812
- Chandra V, Kaur P, Srinivasan A, Singh TP: Three-dimensional structure of a presynaptic neurotoxic phospholipase A2 from Daboia russelli pulchella at 2.4 A resolution. J Mol Biol. 2000 Mar 3;296(4):1117-26. 10686108
- Chandra V, Kaur P, Jasti J, Betzel C, Singh TP: Regulation of catalytic function by molecular association: structure of phospholipase A2 from Daboia russelli pulchella (DPLA2) at 1.9 A resolution. Acta Crystallogr D Biol Crystallogr. 2001 Dec;57(Pt 12):1793-8. Epub 2001 Nov 21. 11717491
- Chandra V, Jasti J, Kaur P, Dey S, Srinivasan A, Betzel Ch, Singh TP: Design of specific peptide inhibitors of phospholipase A2: structure of a complex formed between Russell's viper phospholipase A2 and a designed peptide Leu-Ala-Ile-Tyr-Ser (LAIYS). Acta Crystallogr D Biol Crystallogr. 2002 Oct;58(Pt 10 Pt 2):1813-9. Epub 2002 Sep 28. 12351825
- Chandra V, Jasti J, Kaur P, Srinivasan A, Betzel Ch, Singh TP: Structural basis of phospholipase A2 inhibition for the synthesis of prostaglandins by the plant alkaloid aristolochic acid from a 1.7 A crystal structure. Biochemistry. 2002 Sep 10;41(36):10914-9. 12206661
- Chandra V, Jasti J, Kaur P, Dey S, Perbandt M, Srinivasan A, Betzel Ch, Singh TP: Crystal structure of a complex formed between a snake venom phospholipase A(2) and a potent peptide inhibitor Phe-Leu-Ser-Tyr-Lys at 1.8 A resolution. J Biol Chem. 2002 Oct 25;277(43):41079-85. Epub 2002 Aug 16. 12186870
|
|---|