NameNeurexin-1-beta
Synonyms
  • Neurexin I-beta
Gene NameNRXN1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009039|Neurexin-1-beta
MYQRMLRCGAELGSPGGGGGGGGGGGAGGRLALLWIVPLTLSGLLGVAWGASSLGAHHIH
HFHGSSKHHSVPIAIYRSPASLRGGHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIG
FSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVV
RFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGL
KVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSEMSTSIMETTTTLATSTARR
GKPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRAGGREPYPGSAEVIR
ESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNGAVVKE
KQPSSAKSSNKNKKNKDKEYYV
Number of residues442
Molecular Weight46860.215
Theoretical pINot Available
GO Classification
Functions
  • transmembrane signaling receptor activity
  • receptor binding
  • metal ion binding
  • calcium-dependent protein binding
  • cell adhesion molecule binding
  • neuroligin family protein binding
Processes
  • receptor localization to synapse
  • vocalization behavior
  • adult behavior
  • regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity
  • synapse assembly
  • presynaptic membrane assembly
  • positive regulation of excitatory postsynaptic potential
  • gephyrin clustering involved in postsynaptic density assembly
  • gamma-aminobutyric acid receptor clustering
  • establishment of protein localization
  • neuroligin clustering involved in postsynaptic membrane assembly
  • neuron cell-cell adhesion
  • postsynaptic density protein 95 clustering
  • heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
  • postsynaptic membrane assembly
  • positive regulation of synaptic transmission, glutamatergic
  • calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules
  • regulation of N-methyl-D-aspartate selective glutamate receptor activity
  • angiogenesis
  • cerebellar granule cell differentiation
  • negative regulation of filopodium assembly
  • guanylate kinase-associated protein clustering
  • learning
  • NMDA glutamate receptor clustering
  • neuronal signal transduction
  • positive regulation of establishment of protein localization to plasma membrane
  • social behavior
  • protein complex assembly involved in synapse maturation
  • synaptic vesicle clustering
  • protein localization to synapse
  • signal transduction
Components
  • endoplasmic reticulum
  • plasma membrane
  • cell surface
  • vesicle
  • cell junction
  • integral component of membrane
  • nuclear membrane
  • endocytic vesicle
  • axonal growth cone
  • neuronal cell body
  • presynaptic membrane
General FunctionTransmembrane signaling receptor activity
Specific FunctionNeuronal cell surface protein that may be involved in cell recognition and cell adhesion by forming intracellular junctions through binding to neuroligins. May play a role in formation or maintenance of synaptic junctions. May mediate intracellular signaling. May play a role in angiogenesis (By similarity).
Pfam Domain Function
Transmembrane Regions364-386
GenBank Protein IDNot Available
UniProtKB IDP58400
UniProtKB Entry NameNRX1B_HUMAN
Cellular LocationCell membrane
Gene sequenceNot Available
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:8008
Chromosome LocationNot Available
LocusNot Available
References
  1. Kleiderlein JJ, Nisson PE, Jessee J, Li WB, Becker KG, Derby ML, Ross CA, Margolis RL: CCG repeats in cDNAs from human brain. Hum Genet. 1998 Dec;103(6):666-73. 9921901
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. 15815621
  3. Chen X, Liu H, Shim AH, Focia PJ, He X: Structural basis for synaptic adhesion mediated by neuroligin-neurexin interactions. Nat Struct Mol Biol. 2008 Jan;15(1):50-6. Epub 2007 Dec 16. 18084303