NameHistone H2B type F-S
Synonyms
  • H2B/s
  • Histone H2B.s
Gene NameH2BFS
OrganismHuman
Amino acid sequence
>lcl|BSEQ0021430|Histone H2B type F-S
MPEPAKSAPAPKKGSKKAVTKAQKKDGRKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLPHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
Number of residues126
Molecular Weight13944.085
Theoretical pINot Available
GO Classification
Functions
  • DNA binding
Processes
  • defense response to Gram-positive bacterium
  • innate immune response in mucosa
  • substantia nigra development
  • antibacterial humoral response
Components
  • nucleosome
  • cytoplasm
  • nucleus
  • extracellular space
  • nucleoplasm
General FunctionDna binding
Specific FunctionCore component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP57053
UniProtKB Entry NameH2BFS_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0021431|Histone H2B type F-S (H2BFS)
ATGCCGGAGCCAGCGAAGTCCGCTCCCGCGCCCAAGAAGGGCTCGAAGAAAGCCGTGACT
AAGGCGCAGAAGAAGGACGGCAGGAAGCGCAAGCGCAGCCGCAAGGAGAGCTACTCCGTA
TACGTGTACAAGGTGCTGAAGCAGGTCCACCCCGACACCGGCATCTCCTCTAAGGCCATG
GGAATCATGAACTCCTTCGTCAACGACATCTTCGAACGCATCGCAGGTGAGGCTTCCCGC
CTGCCGCATTACAACAAGCGCTCGACCATCACCTCCAGGGAGATCCAGACGGCCGTGCGC
CTGCTGCTGCCCGGGGAGTTGGCCAAGCACGCCGTGTCCGAGGGCACCAAGGCCGTCACC
AAGTACACCAGCGCTAAGTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:4762
Chromosome LocationNot Available
LocusNot Available
References
  1. Hattori M, Fujiyama A, Taylor TD, Watanabe H, Yada T, Park HS, Toyoda A, Ishii K, Totoki Y, Choi DK, Groner Y, Soeda E, Ohki M, Takagi T, Sakaki Y, Taudien S, Blechschmidt K, Polley A, Menzel U, Delabar J, Kumpf K, Lehmann R, Patterson D, Reichwald K, Rump A, Schillhabel M, Schudy A, Zimmermann W, Rosenthal A, Kudoh J, Schibuya K, Kawasaki K, Asakawa S, Shintani A, Sasaki T, Nagamine K, Mitsuyama S, Antonarakis SE, Minoshima S, Shimizu N, Nordsiek G, Hornischer K, Brant P, Scharfe M, Schon O, Desario A, Reichelt J, Kauer G, Blocker H, Ramser J, Beck A, Klages S, Hennig S, Riesselmann L, Dagand E, Haaf T, Wehrmeyer S, Borzym K, Gardiner K, Nizetic D, Francis F, Lehrach H, Reinhardt R, Yaspo ML: The DNA sequence of human chromosome 21. Nature. 2000 May 18;405(6784):311-9. 10830953
  2. Kim HS, Cho JH, Park HW, Yoon H, Kim MS, Kim SC: Endotoxin-neutralizing antimicrobial proteins of the human placenta. J Immunol. 2002 Mar 1;168(5):2356-64. 11859126
  3. Frohm M, Gunne H, Bergman AC, Agerberth B, Bergman T, Boman A, Liden S, Jornvall H, Boman HG: Biochemical and antibacterial analysis of human wound and blister fluid. Eur J Biochem. 1996 Apr 1;237(1):86-92. 8620898
  4. Tollin M, Bergman P, Svenberg T, Jornvall H, Gudmundsson GH, Agerberth B: Antimicrobial peptides in the first line defence of human colon mucosa. Peptides. 2003 Apr;24(4):523-30. 12860195
  5. Howell SJ, Wilk D, Yadav SP, Bevins CL: Antimicrobial polypeptides of the human colonic epithelium. Peptides. 2003 Nov;24(11):1763-70. 15019208
  6. Beck HC, Nielsen EC, Matthiesen R, Jensen LH, Sehested M, Finn P, Grauslund M, Hansen AM, Jensen ON: Quantitative proteomic analysis of post-translational modifications of human histones. Mol Cell Proteomics. 2006 Jul;5(7):1314-25. Epub 2006 Apr 20. 16627869
  7. Cheung WL, Ajiro K, Samejima K, Kloc M, Cheung P, Mizzen CA, Beeser A, Etkin LD, Chernoff J, Earnshaw WC, Allis CD: Apoptotic phosphorylation of histone H2B is mediated by mammalian sterile twenty kinase. Cell. 2003 May 16;113(4):507-17. 12757711
  8. Zhu B, Zheng Y, Pham AD, Mandal SS, Erdjument-Bromage H, Tempst P, Reinberg D: Monoubiquitination of human histone H2B: the factors involved and their roles in HOX gene regulation. Mol Cell. 2005 Nov 23;20(4):601-11. 16307923
  9. Golebiowski F, Kasprzak KS: Inhibition of core histones acetylation by carcinogenic nickel(II). Mol Cell Biochem. 2005 Nov;279(1-2):133-9. 16283522
  10. Pavri R, Zhu B, Li G, Trojer P, Mandal S, Shilatifard A, Reinberg D: Histone H2B monoubiquitination functions cooperatively with FACT to regulate elongation by RNA polymerase II. Cell. 2006 May 19;125(4):703-17. 16713563
  11. Tan M, Luo H, Lee S, Jin F, Yang JS, Montellier E, Buchou T, Cheng Z, Rousseaux S, Rajagopal N, Lu Z, Ye Z, Zhu Q, Wysocka J, Ye Y, Khochbin S, Ren B, Zhao Y: Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification. Cell. 2011 Sep 16;146(6):1016-28. doi: 10.1016/j.cell.2011.08.008. 21925322
  12. Wu L, Zee BM, Wang Y, Garcia BA, Dou Y: The RING finger protein MSL2 in the MOF complex is an E3 ubiquitin ligase for H2B K34 and is involved in crosstalk with H3 K4 and K79 methylation. Mol Cell. 2011 Jul 8;43(1):132-44. doi: 10.1016/j.molcel.2011.05.015. 21726816
  13. Zhang Z, Jones A, Joo HY, Zhou D, Cao Y, Chen S, Erdjument-Bromage H, Renfrow M, He H, Tempst P, Townes TM, Giles KE, Ma L, Wang H: USP49 deubiquitinates histone H2B and regulates cotranscriptional pre-mRNA splicing. Genes Dev. 2013 Jul 15;27(14):1581-95. doi: 10.1101/gad.211037.112. Epub 2013 Jul 3. 23824326