NameSodium/potassium-transporting ATPase subunit gamma
Synonyms
  • ATP1C
  • ATP1G1
  • FXYD domain-containing ion transport regulator 2
  • Na(+)/K(+) ATPase subunit gamma
  • Sodium pump gamma chain
Gene NameFXYD2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0000457|Sodium/potassium-transporting ATPase subunit gamma
MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQ
INEDEP
Number of residues66
Molecular Weight7283.265
Theoretical pI8.47
GO Classification
Functions
  • sodium
  • sodium channel regulator activity
  • transporter activity
  • ion channel activity
Processes
  • transmembrane transport
  • ion transmembrane transport
  • ATP hydrolysis coupled transmembrane transport
  • establishment or maintenance of transmembrane electrochemical gradient
  • potassium ion import across plasma membrane
  • transport
  • regulation of sodium ion transmembrane transporter activity
  • sodium ion export from cell
  • regulation of cell growth
  • regulation of cell proliferation
Components
  • integral component of plasma membrane
  • intracellular membrane-bounded organelle
  • basolateral plasma membrane
  • sodium
  • plasma membrane
  • extracellular exosome
General FunctionTransporter activity
Specific FunctionMay be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.
Pfam Domain Function
Transmembrane Regions29-46
GenBank Protein ID1575004
UniProtKB IDP54710
UniProtKB Entry NameATNG_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0010020|Sodium/potassium-transporting ATPase subunit gamma (FXYD2)
ATGACTGGGTTGTCGATGGACGGTGGCGGCAGCCCCAAGGGGGACGTGGACCCGTTCTAC
TATGACTATGAGACCGTTCGCAATGGGGGCCTGATCTTCGCTGGACTGGCCTTCATCGTG
GGGCTCCTCATCCTCCTCAGCAGAAGATTCCGCTGTGGGGGCAATAAGAAGCGCAGGCAA
ATCAATGAAGATGAGCCGTAA
GenBank Gene IDU50743
GeneCard IDNot Available
GenAtlas IDFXYD2
HGNC IDHGNC:4026
Chromosome Location11
Locus11q23
References
  1. Kim JW, Lee Y, Lee IA, Kang HB, Choe YK, Choe IS: Cloning and expression of human cDNA encoding Na+, K(+)-ATPase gamma-subunit. Biochim Biophys Acta. 1997 Feb 7;1350(2):133-5. 9048881
  2. Sweadner KJ, Wetzel RK, Arystarkhova E: Genomic organization of the human FXYD2 gene encoding the gamma subunit of the Na,K-ATPase. Biochem Biophys Res Commun. 2000 Dec 9;279(1):196-201. 11112438
  3. Meij IC, Koenderink JB, van Bokhoven H, Assink KF, Groenestege WT, de Pont JJ, Bindels RJ, Monnens LA, van den Heuvel LP, Knoers NV: Dominant isolated renal magnesium loss is caused by misrouting of the Na(+),K(+)-ATPase gamma-subunit. Nat Genet. 2000 Nov;26(3):265-6. 11062458
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334