NameDNA-directed RNA polymerases I, II, and III subunit RPABC4
Synonyms
  • ABC10-alpha
  • DNA-directed RNA polymerase II subunit K
  • RNA polymerase II 7.0 kDa subunit
  • RNA polymerases I, II, and III subunit ABC4
  • RPB10alpha
  • RPB7.0
Gene NamePOLR2K
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013654|DNA-directed RNA polymerases I, II, and III subunit RPABC4
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
Number of residues58
Molecular Weight7004.145
Theoretical pINot Available
GO Classification
Functions
  • DNA-directed RNA polymerase activity
  • zinc ion binding
  • DNA binding
Processes
  • transcription initiation from RNA polymerase I promoter
  • positive regulation of type I interferon production
  • regulation of transcription from RNA polymerase I promoter
  • 7-methylguanosine mRNA capping
  • DNA repair
  • gene silencing by RNA
  • nucleotide-excision repair
  • mRNA splicing, via spliceosome
  • transcription from RNA polymerase II promoter
  • piRNA metabolic process
  • positive regulation of viral transcription
  • gene expression
  • RNA splicing
  • transcription initiation from RNA polymerase II promoter
  • transcription elongation from RNA polymerase II promoter
  • innate immune response
  • termination of RNA polymerase I transcription
  • somatic stem cell population maintenance
  • termination of RNA polymerase III transcription
  • transcription-coupled nucleotide-excision repair
  • transcription elongation from RNA polymerase I promoter
  • viral process
  • transcription elongation from RNA polymerase III promoter
  • negative regulation of gene expression, epigenetic
  • transcription from RNA polymerase I promoter
  • transcription from RNA polymerase III promoter
  • regulation of gene expression, epigenetic
Components
  • nucleus
  • DNA-directed RNA polymerase II, core complex
  • cytosol
  • DNA-directed RNA polymerase I complex
  • nucleoplasm
  • DNA-directed RNA polymerase III complex
General FunctionZinc ion binding
Specific FunctionDNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP53803
UniProtKB Entry NameRPAB4_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0013655|DNA-directed RNA polymerases I, II, and III subunit RPABC4 (POLR2K)
ATGGACACCCAGAAGGACGTTCAACCTCCAAAGCAGCAACCAATGATATATATCTGTGGA
GAGTGTCACACAGAAAATGAAATAAAATCTAGGGATCCAATCAGATGCAGAGAATGTGGA
TACAGAATAATGTACAAGAAAAGGACTAAAAGATTGGTCGTTTTTGATGCTCGATGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9198
Chromosome Location8
LocusNot Available
References
  1. Shpakovski GV, Acker J, Wintzerith M, Lacroix JF, Thuriaux P, Vigneron M: Four subunits that are shared by the three classes of RNA polymerase are functionally interchangeable between Homo sapiens and Saccharomyces cerevisiae. Mol Cell Biol. 1995 Sep;15(9):4702-10. 7651387
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334