NameDual specificity protein phosphatase 3
Synonyms
  • 3.1.3.16
  • Dual specificity protein phosphatase VHR
  • Vaccinia H1-related phosphatase
  • VHR
Gene NameDUSP3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009213|Dual specificity protein phosphatase 3
MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
Number of residues185
Molecular Weight20478.1
Theoretical pINot Available
GO Classification
Functions
  • MAP kinase phosphatase activity
  • protein tyrosine phosphatase activity
  • protein tyrosine/serine/threonine phosphatase activity
  • protein kinase binding
Processes
  • stress-activated MAPK cascade
  • toll-like receptor 10 signaling pathway
  • toll-like receptor 2 signaling pathway
  • toll-like receptor 3 signaling pathway
  • toll-like receptor 4 signaling pathway
  • toll-like receptor 5 signaling pathway
  • toll-like receptor 9 signaling pathway
  • innate immune response
  • toll-like receptor signaling pathway
  • neurotrophin TRK receptor signaling pathway
  • toll-like receptor TLR1
  • toll-like receptor TLR6
  • positive regulation of mitotic cell cycle
  • TRIF-dependent toll-like receptor signaling pathway
  • negative regulation of JNK cascade
  • negative regulation of ERK1 and ERK2 cascade
  • peptidyl-tyrosine dephosphorylation
  • negative regulation of MAPK cascade
  • inactivation of MAPK activity
  • negative regulation of T cell receptor signaling pathway
  • MyD88-dependent toll-like receptor signaling pathway
  • negative regulation of T cell activation
  • MyD88-independent toll-like receptor signaling pathway
Components
  • cytoplasm
  • nucleus
  • cytosol
  • extracellular exosome
  • nucleoplasm
  • immunological synapse
General FunctionProtein tyrosine/serine/threonine phosphatase activity
Specific FunctionShows activity both for tyrosine-protein phosphate and serine-protein phosphate, but displays a strong preference toward phosphotyrosines. Specifically dephosphorylates and inactivates ERK1 and ERK2.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP51452
UniProtKB Entry NameDUS3_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0013676|Dual specificity protein phosphatase 3 (DUSP3)
ATGTCGGGCTCGTTCGAGCTCTCGGTGCAGGATCTCAACGACCTGCTCTCGGACGGCAGC
GGCTGCTACAGCCTCCCGAGCCAGCCCTGCAACGAGGTCACCCCGCGGATCTACGTGGGC
AACGCGTCTGTGGCTCAGGACATCCCCAAGCTGCAGAAACTAGGCATCACCCATGTGCTG
AACGCGGCTGAGGGCAGGTCCTTCATGCACGTCAACACCAATGCCAACTTCTACAAGGAC
TCCGGCATCACATACCTGGGCATCAAGGCCAACGACACACAGGAGTTCAACCTCAGCGCT
TACTTTGAAAGGGCTGCCGACTTCATTGACCAGGCTTTGGCTCAAAAGAATGGCCGGGTG
CTCGTCCACTGCCGGGAAGGTTATAGCCGCTCCCCAACGCTAGTTATCGCCTACCTCATG
ATGCGGCAGAAGATGGACGTCAAGTCTGCCCTGAGCATCGTGAGGCAGAACCGTGAGATC
GGCCCCAACGATGGCTTCCTGGCCCAGCTCTGCCAGCTCAATGACAGACTAGCCAAGGAG
GGGAAGTTGAAACCCTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:3069
Chromosome Location17
LocusNot Available
References
  1. Ishibashi T, Bottaro DP, Chan A, Miki T, Aaronson SA: Expression cloning of a human dual-specificity phosphatase. Proc Natl Acad Sci U S A. 1992 Dec 15;89(24):12170-4. 1281549
  2. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. 16625196
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Todd JL, Tanner KG, Denu JM: Extracellular regulated kinases (ERK) 1 and ERK2 are authentic substrates for the dual-specificity protein-tyrosine phosphatase VHR. A novel role in down-regulating the ERK pathway. J Biol Chem. 1999 May 7;274(19):13271-80. 10224087
  5. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  6. Yuvaniyama J, Denu JM, Dixon JE, Saper MA: Crystal structure of the dual specificity protein phosphatase VHR. Science. 1996 May 31;272(5266):1328-31. 8650541
  7. Schumacher MA, Todd JL, Rice AE, Tanner KG, Denu JM: Structural basis for the recognition of a bisphosphorylated MAP kinase peptide by human VHR protein Phosphatase. Biochemistry. 2002 Mar 5;41(9):3009-17. 11863439
  8. Wu S, Vossius S, Rahmouni S, Miletic AV, Vang T, Vazquez-Rodriguez J, Cerignoli F, Arimura Y, Williams S, Hayes T, Moutschen M, Vasile S, Pellecchia M, Mustelin T, Tautz L: Multidentate small-molecule inhibitors of vaccinia H1-related (VHR) phosphatase decrease proliferation of cervix cancer cells. J Med Chem. 2009 Nov 12;52(21):6716-23. doi: 10.1021/jm901016k. 19888758