NameCasein kinase I isoform delta
Synonyms
  • 2.7.11.1
  • CKI-delta
  • HCKID
  • Tau-protein kinase CSNK1D
Gene NameCSNK1D
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009211|Casein kinase I isoform delta
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR
Number of residues415
Molecular Weight47329.66
Theoretical pINot Available
GO Classification
Functions
  • tau-protein kinase activity
  • ATP binding
  • protein kinase activity
  • protein serine/threonine kinase activity
  • peptide binding
Processes
  • G2/M transition of mitotic cell cycle
  • protein localization to centrosome
  • mitotic cell cycle
  • protein localization to cilium
  • organelle organization
  • protein localization to Golgi apparatus
  • peptidyl-serine phosphorylation
  • positive regulation of protein phosphorylation
  • endocytosis
  • positive regulation of canonical Wnt signaling pathway
  • positive regulation of proteasomal ubiquitin-dependent protein catabolic process
  • cellular protein metabolic process
  • regulation of circadian rhythm
  • spindle assembly
  • protein phosphorylation
  • signal transduction
  • Wnt signaling pathway
  • circadian regulation of gene expression
  • COPII vesicle coating
  • ER to Golgi vesicle-mediated transport
  • membrane organization
  • post-translational protein modification
  • DNA repair
  • microtubule nucleation
  • protein N-linked glycosylation via asparagine
  • Golgi organization
  • regulation of cell shape
  • nonmotile primary cilium assembly
Components
  • Golgi apparatus
  • cytosol
  • perinuclear region of cytoplasm
  • cytoplasm
  • centrosome
  • endoplasmic reticulum-Golgi intermediate compartment membrane
  • Golgi membrane
  • spindle microtubule
  • nucleus
  • spindle
  • plasma membrane
General FunctionTau-protein kinase activity
Specific FunctionEssential serine/threonine-protein kinase that regulates diverse cellular growth and survival processes including Wnt signaling, DNA repair and circadian rhythms. It can phosphorylate a large number of proteins. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. Phosphorylates connexin-43/GJA1, MAP1A, SNAPIN, MAPT/TAU, TOP2A, DCK, HIF1A, EIF6, p53/TP53, DVL2, DVL3, ESR1, AIB1/NCOA3, DNMT1, PKD2, YAP1, PER1 and PER2. Central component of the circadian clock. In balance with PP1, determines the circadian period length through the regulation of the speed and rhythmicity of PER1 and PER2 phospohorylation. Controls PER1 and PER2 nuclear transport and degradation. YAP1 phosphorylation promotes its SCF(beta-TRCP) E3 ubiquitin ligase-mediated ubiquitination and subsequent degradation. DNMT1 phosphorylation reduces its DNA-binding activity. Phosphorylation of ESR1 and AIB1/NCOA3 stimulates their activity and coactivation. Phosphorylation of DVL2 and DVL3 regulates WNT3A signaling pathway that controls neurite outgrowth. EIF6 phosphorylation promotes its nuclear export. Triggers down-regulation of dopamine receptors in the forebrain. Activates DCK in vitro by phosphorylation. TOP2A phosphorylation favors DNA cleavable complex formation. May regulate the formation of the mitotic spindle apparatus in extravillous trophoblast. Modulates connexin-43/GJA1 gap junction assembly by phosphorylation. Probably involved in lymphocyte physiology. Regulates fast synaptic transmission mediated by glutamate.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP48730
UniProtKB Entry NameKC1D_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0013675|Casein kinase I isoform delta (CSNK1D)
ATGGAGCTGAGAGTCGGGAACAGGTACCGGCTGGGCCGGAAGATCGGCAGCGGCTCCTTC
GGAGACATCTATCTCGGTACGGACATTGCTGCAGGAGAAGAGGTTGCCATCAAGCTTGAA
TGTGTCAAAACCAAACACCCTCAGCTCCACATTGAGAGCAAAATCTACAAGATGATGCAG
GGAGGAGTGGGCATCCCCACCATCAGATGGTGCGGGGCAGAGGGGGACTACAACGTCATG
GTGATGGAGCTGCTGGGGCCAAGCCTGGAGGACCTCTTCAACTTCTGCTCCAGGAAATTC
AGCCTCAAAACCGTCCTGCTGCTTGCTGACCAAATGATCAGTCGCATCGAATACATTCAT
TCAAAGAACTTCATCCACCGGGATGTGAAGCCAGACAACTTCCTCATGGGCCTGGGGAAG
AAGGGCAACCTGGTGTACATCATCGACTTCGGGCTGGCCAAGAAGTACCGGGATGCACGC
ACCCACCAGCACATCCCCTATCGTGAGAACAAGAACCTCACGGGGACGGCGCGGTACGCC
TCCATCAACACGCACCTTGGAATTGAACAATCCCGAAGAGATGACTTGGAGTCTCTGGGC
TACGTGCTAATGTACTTCAACCTGGGCTCTCTCCCCTGGCAGGGGCTGAAGGCTGCCACC
AAGAGACAGAAATACGAAAGGATTAGCGAGAAGAAAATGTCCACCCCCATCGAAGTGTTG
TGTAAAGGCTACCCTTCCGAATTTGCCACATACCTGAATTTCTGCCGTTCCTTGCGTTTT
GACGACAAGCCTGACTACTCGTACCTGCGGCAGCTTTTCCGGAATCTGTTCCATCGCCAG
GGCTTCTCCTATGACTACGTGTTCGACTGGAACATGCTCAAATTTGGTGCCAGCCGGGCC
GCCGATGACGCCGAGCGGGAGCGCAGGGACCGAGAGGAGCGGCTGAGACACTCGCGGAAC
CCGGCTACCCGCGGCCTCCCTTCCACAGCCTCCGGCCGCCTGCGGGGGACGCAGGAAGTG
GCTCCCCCCACACCCCTCACCCCTACCTCACACACGGCTAACACCTCCCCCCGGCCCGTC
TCCGGCATGGAGAGAGAGCGGAAAGTGAGTATGCGGCTGCACCGCGGGGCCCCCGTCAAC
ATCTCCTCGTCCGACCTCACAGGCCGACAAGATACCTCTCGCATGTCCACCTCACAGATT
CCTGGTCGGGTGGCTTCCAGTGGTCTTCAGTCTGTCGTGCACCGATGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:2452
Chromosome Location17
LocusNot Available
References
  1. Kusuda J, Hidari N, Hirai M, Hashimoto K: Sequence analysis of the cDNA for the human casein kinase I delta (CSNK1D) gene and its chromosomal localization. Genomics. 1996 Feb 15;32(1):140-3. 8786104
  2. Okamura A, Iwata N, Nagata A, Tamekane A, Shimoyama M, Gomyo H, Yakushijin K, Urahama N, Hamaguchi M, Fukui C, Chihara K, Ito M, Matsui T: Involvement of casein kinase Iepsilon in cytokine-induced granulocytic differentiation. Blood. 2004 Apr 15;103(8):2997-3004. Epub 2004 Jan 8. 15070676
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Rivers A, Gietzen KF, Vielhaber E, Virshup DM: Regulation of casein kinase I epsilon and casein kinase I delta by an in vivo futile phosphorylation cycle. J Biol Chem. 1998 Jun 26;273(26):15980-4. 9632646
  6. Dumaz N, Milne DM, Meek DW: Protein kinase CK1 is a p53-threonine 18 kinase which requires prior phosphorylation of serine 15. FEBS Lett. 1999 Dec 17;463(3):312-6. 10606744
  7. Behrend L, Stoter M, Kurth M, Rutter G, Heukeshoven J, Deppert W, Knippschild U: Interaction of casein kinase 1 delta (CK1delta) with post-Golgi structures, microtubules and the spindle apparatus. Eur J Cell Biol. 2000 Apr;79(4):240-51. 10826492
  8. Milne DM, Looby P, Meek DW: Catalytic activity of protein kinase CK1 delta (casein kinase 1delta) is essential for its normal subcellular localization. Exp Cell Res. 2001 Feb 1;263(1):43-54. 11161704
  9. Camacho F, Cilio M, Guo Y, Virshup DM, Patel K, Khorkova O, Styren S, Morse B, Yao Z, Keesler GA: Human casein kinase Idelta phosphorylation of human circadian clock proteins period 1 and 2. FEBS Lett. 2001 Feb 2;489(2-3):159-65. 11165242
  10. Cooper CD, Lampe PD: Casein kinase 1 regulates connexin-43 gap junction assembly. J Biol Chem. 2002 Nov 22;277(47):44962-8. Epub 2002 Sep 20. 12270943
  11. Sillibourne JE, Milne DM, Takahashi M, Ono Y, Meek DW: Centrosomal anchoring of the protein kinase CK1delta mediated by attachment to the large, coiled-coil scaffolding protein CG-NAP/AKAP450. J Mol Biol. 2002 Sep 27;322(4):785-97. 12270714
  12. Li G, Yin H, Kuret J: Casein kinase 1 delta phosphorylates tau and disrupts its binding to microtubules. J Biol Chem. 2004 Apr 16;279(16):15938-45. Epub 2004 Feb 2. 14761950
  13. Stoter M, Bamberger AM, Aslan B, Kurth M, Speidel D, Loning T, Frank HG, Kaufmann P, Lohler J, Henne-Bruns D, Deppert W, Knippschild U: Inhibition of casein kinase I delta alters mitotic spindle formation and induces apoptosis in trophoblast cells. Oncogene. 2005 Dec 1;24(54):7964-75. 16027726
  14. Yin H, Laguna KA, Li G, Kuret J: Dysbindin structural homologue CK1BP is an isoform-selective binding partner of human casein kinase-1. Biochemistry. 2006 Apr 25;45(16):5297-308. 16618118
  15. von Blume J, Knippschild U, Dequiedt F, Giamas G, Beck A, Auer A, Van Lint J, Adler G, Seufferlein T: Phosphorylation at Ser244 by CK1 determines nuclear localization and substrate targeting of PKD2. EMBO J. 2007 Nov 14;26(22):4619-33. Epub 2007 Oct 25. 17962809
  16. Hanger DP, Byers HL, Wray S, Leung KY, Saxton MJ, Seereeram A, Reynolds CH, Ward MA, Anderton BH: Novel phosphorylation sites in tau from Alzheimer brain support a role for casein kinase 1 in disease pathogenesis. J Biol Chem. 2007 Aug 10;282(32):23645-54. Epub 2007 Jun 11. 17562708
  17. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. 18220336
  18. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. 18691976
  19. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  20. Peifer C, Abadleh M, Bischof J, Hauser D, Schattel V, Hirner H, Knippschild U, Laufer S: 3,4-Diaryl-isoxazoles and -imidazoles as potent dual inhibitors of p38alpha mitogen activated protein kinase and casein kinase 1delta. J Med Chem. 2009 Dec 10;52(23):7618-30. doi: 10.1021/jm9005127. 19591487
  21. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. 19369195
  22. Grozav AG, Chikamori K, Kozuki T, Grabowski DR, Bukowski RM, Willard B, Kinter M, Andersen AH, Ganapathi R, Ganapathi MK: Casein kinase I delta/epsilon phosphorylates topoisomerase IIalpha at serine-1106 and modulates DNA cleavage activity. Nucleic Acids Res. 2009 Feb;37(2):382-92. doi: 10.1093/nar/gkn934. Epub 2008 Nov 29. 19043076
  23. Giamas G, Castellano L, Feng Q, Knippschild U, Jacob J, Thomas RS, Coombes RC, Smith CL, Jiao LR, Stebbing J: CK1delta modulates the transcriptional activity of ERalpha via AIB1 in an estrogen-dependent manner and regulates ERalpha-AIB1 interactions. Nucleic Acids Res. 2009 May;37(9):3110-23. doi: 10.1093/nar/gkp136. Epub 2009 Apr 1. 19339517
  24. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  25. Smal C, Vertommen D, Amsailale R, Arts A, Degand H, Morsomme P, Rider MH, Neste EV, Bontemps F: Casein kinase 1delta activates human recombinant deoxycytidine kinase by Ser-74 phosphorylation, but is not involved in the in vivo regulation of its activity. Arch Biochem Biophys. 2010 Oct 1;502(1):44-52. doi: 10.1016/j.abb.2010.07.009. Epub 2010 Jul 14. 20637175
  26. Venerando A, Marin O, Cozza G, Bustos VH, Sarno S, Pinna LA: Isoform specific phosphorylation of p53 by protein kinase CK1. Cell Mol Life Sci. 2010 Apr;67(7):1105-18. doi: 10.1007/s00018-009-0236-7. Epub 2009 Dec 30. 20041275
  27. Zhao B, Li L, Tumaneng K, Wang CY, Guan KL: A coordinated phosphorylation by Lats and CK1 regulates YAP stability through SCF(beta-TRCP). Genes Dev. 2010 Jan 1;24(1):72-85. doi: 10.1101/gad.1843810. 20048001
  28. Kalousi A, Mylonis I, Politou AS, Chachami G, Paraskeva E, Simos G: Casein kinase 1 regulates human hypoxia-inducible factor HIF-1. J Cell Sci. 2010 Sep 1;123(Pt 17):2976-86. doi: 10.1242/jcs.068122. Epub 2010 Aug 10. 20699359
  29. Meng QJ, Maywood ES, Bechtold DA, Lu WQ, Li J, Gibbs JE, Dupre SM, Chesham JE, Rajamohan F, Knafels J, Sneed B, Zawadzke LE, Ohren JF, Walton KM, Wager TT, Hastings MH, Loudon AS: Entrainment of disrupted circadian behavior through inhibition of casein kinase 1 (CK1) enzymes. Proc Natl Acad Sci U S A. 2010 Aug 24;107(34):15240-5. doi: 10.1073/pnas.1005101107. Epub 2010 Aug 9. 20696890
  30. Sprouse J, Reynolds L, Kleiman R, Tate B, Swanson TA, Pickard GE: Chronic treatment with a selective inhibitor of casein kinase I delta/epsilon yields cumulative phase delays in circadian rhythms. Psychopharmacology (Berl). 2010 Jul;210(4):569-76. doi: 10.1007/s00213-010-1860-5. Epub 2010 Apr 21. 20407760
  31. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  32. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  33. Biswas A, Mukherjee S, Das S, Shields D, Chow CW, Maitra U: Opposing action of casein kinase 1 and calcineurin in nucleo-cytoplasmic shuttling of mammalian translation initiation factor eIF6. J Biol Chem. 2011 Jan 28;286(4):3129-38. doi: 10.1074/jbc.M110.188565. Epub 2010 Nov 17. 21084295
  34. Greer YE, Rubin JS: Casein kinase 1 delta functions at the centrosome to mediate Wnt-3a-dependent neurite outgrowth. J Cell Biol. 2011 Mar 21;192(6):993-1004. doi: 10.1083/jcb.201011111. 21422228
  35. Cheong JK, Nguyen TH, Wang H, Tan P, Voorhoeve PM, Lee SH, Virshup DM: IC261 induces cell cycle arrest and apoptosis of human cancer cells via CK1delta/varepsilon and Wnt/beta-catenin independent inhibition of mitotic spindle formation. Oncogene. 2011 Jun 2;30(22):2558-69. doi: 10.1038/onc.2010.627. Epub 2011 Jan 24. 21258417
  36. Cheong JK, Virshup DM: Casein kinase 1: Complexity in the family. Int J Biochem Cell Biol. 2011 Apr;43(4):465-9. doi: 10.1016/j.biocel.2010.12.004. Epub 2010 Dec 9. 21145983
  37. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  38. Longenecker KL, Roach PJ, Hurley TD: Crystallographic studies of casein kinase I delta toward a structural understanding of auto-inhibition. Acta Crystallogr D Biol Crystallogr. 1998 May 1;54(Pt 3):473-5. 9761932
  39. Long A, Zhao H, Huang X: Structural basis for the interaction between casein kinase 1 delta and a potent and selective inhibitor. J Med Chem. 2012 Jan 26;55(2):956-60. doi: 10.1021/jm201387s. Epub 2012 Jan 5. 22168824
  40. Long AM, Zhao H, Huang X: Structural basis for the potent and selective inhibition of casein kinase 1 epsilon. J Med Chem. 2012 Nov 26;55(22):10307-11. doi: 10.1021/jm301336n. Epub 2012 Nov 9. 23106386
  41. Xu Y, Padiath QS, Shapiro RE, Jones CR, Wu SC, Saigoh N, Saigoh K, Ptacek LJ, Fu YH: Functional consequences of a CKIdelta mutation causing familial advanced sleep phase syndrome. Nature. 2005 Mar 31;434(7033):640-4. 15800623
  42. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974
  43. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. 17344846
  44. Brennan KC, Bates EA, Shapiro RE, Zyuzin J, Hallows WC, Huang Y, Lee HY, Jones CR, Fu YH, Charles AC, Ptacek LJ: Casein kinase idelta mutations in familial migraine and advanced sleep phase. Sci Transl Med. 2013 May 1;5(183):183ra56, 1-11. doi: 10.1126/scitranslmed.3005784. 23636092