Ergosterol biosynthetic protein 28

NameErgosterol biosynthetic protein 28
Synonyms
  • BUD18
Gene NameERG28
OrganismBaker's yeast
Amino acid sequence
>lcl|BSEQ0013595|Ergosterol biosynthetic protein 28
MFSLQDVITTTKTTLAAMPKGYLPKWLLFISIVSVFNSIQTYVSGLELTRKVYERKPTET
THLSARTFGTWTFISCVIRFYGAMYLNEPHIFELVFMSYMVALFHFGSELLIFRTCKLGK
GFMGPLVVSTTSLVWMYKQREYYTGVAW
Number of residues148
Molecular Weight17135.105
Theoretical pINot Available
GO Classification
Functions
  • protein binding, bridging
Processes
  • ergosterol biosynthetic process
Components
  • endoplasmic reticulum membrane
  • integral component of membrane
General FunctionProtein binding, bridging
Specific FunctionHas a role as a scaffold to help anchor ERG25, ERG26 and ERG27 to the endoplasmic reticulum. May also be responsible for facilitating their interaction.
Pfam Domain Function
Transmembrane Regions26-46 93-113 121-136
GenBank Protein IDNot Available
UniProtKB IDP40030
UniProtKB Entry NameERG28_YEAST
Cellular LocationEndoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0013596|Ergosterol biosynthetic protein 28 (ERG28)
ATGTTCAGCCTACAAGACGTAATAACTACAACCAAGACCACCTTGGCAGCAATGCCAAAA
GGTTACTTACCAAAATGGTTACTTTTCATTTCCATTGTATCAGTCTTCAATTCTATCCAG
ACTTACGTTTCTGGTTTAGAATTGACACGTAAAGTCTACGAAAGAAAACCCACTGAAACA
ACCCATTTGAGTGCAAGAACTTTCGGTACTTGGACCTTTATTTCCTGTGTTATCAGATTC
TATGGGGCTATGTACTTGAATGAACCACACATTTTCGAATTGGTCTTCATGTCTTATATG
GTTGCCCTATTCCACTTCGGCTCTGAATTATTGATCTTTAGAACTTGTAAGTTGGGAAAG
GGATTCATGGGTCCATTGGTTGTCTCAACCACCTCTTTGGTTTGGATGTACAAACAAAGA
GAATACTACACTGGTGTTGCTTGGTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDNot Available
Chromosome LocationNot Available
LocusNot Available
References
  1. Dietrich FS, Mulligan J, Hennessy K, Yelton MA, Allen E, Araujo R, Aviles E, Berno A, Brennan T, Carpenter J, Chen E, Cherry JM, Chung E, Duncan M, Guzman E, Hartzell G, Hunicke-Smith S, Hyman RW, Kayser A, Komp C, Lashkari D, Lew H, Lin D, Mosedale D, Davis RW, et al.: The nucleotide sequence of Saccharomyces cerevisiae chromosome V. Nature. 1997 May 29;387(6632 Suppl):78-81. 9169868
  2. Engel SR, Dietrich FS, Fisk DG, Binkley G, Balakrishnan R, Costanzo MC, Dwight SS, Hitz BC, Karra K, Nash RS, Weng S, Wong ED, Lloyd P, Skrzypek MS, Miyasato SR, Simison M, Cherry JM: The reference genome sequence of Saccharomyces cerevisiae: then and now. G3 (Bethesda). 2014 Mar 20;4(3):389-98. doi: 10.1534/g3.113.008995. 24374639
  3. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J: Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Genome Res. 2007 Apr;17(4):536-43. Epub 2007 Feb 23. 17322287
  4. Gachotte D, Eckstein J, Barbuch R, Hughes T, Roberts C, Bard M: A novel gene conserved from yeast to humans is involved in sterol biosynthesis. J Lipid Res. 2001 Jan;42(1):150-4. 11160377
  5. Mo C, Valachovic M, Randall SK, Nickels JT, Bard M: Protein-protein interactions among C-4 demethylation enzymes involved in yeast sterol biosynthesis. Proc Natl Acad Sci U S A. 2002 Jul 23;99(15):9739-44. Epub 2002 Jul 15. 12119386
  6. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS: Global analysis of protein expression in yeast. Nature. 2003 Oct 16;425(6959):737-41. 14562106
  7. Mo C, Valachovic M, Bard M: The ERG28-encoded protein, Erg28p, interacts with both the sterol C-4 demethylation enzyme complex as well as the late biosynthetic protein, the C-24 sterol methyltransferase (Erg6p). Biochim Biophys Acta. 2004 Nov 8;1686(1-2):30-6. 15522820
  8. Mo C, Bard M: Erg28p is a key protein in the yeast sterol biosynthetic enzyme complex. J Lipid Res. 2005 Sep;46(9):1991-8. Epub 2005 Jul 1. 15995173
  9. Kim H, Melen K, Osterberg M, von Heijne G: A global topology map of the Saccharomyces cerevisiae membrane proteome. Proc Natl Acad Sci U S A. 2006 Jul 25;103(30):11142-7. Epub 2006 Jul 17. 16847258