| Name | Ig lambda-1 chain C regions |
|---|
| Synonyms | Not Available |
|---|
| Gene Name | IGLC1 |
|---|
| Organism | Human |
|---|
| Amino acid sequence | >lcl|BSEQ0009386|Ig lambda-1 chain C regions
GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSK
QSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS |
|---|
| Number of residues | 106 |
|---|
| Molecular Weight | 11347.585 |
|---|
| Theoretical pI | Not Available |
|---|
| GO Classification | Functions - antigen binding
- immunoglobulin receptor binding
Processes - Fc-gamma receptor signaling pathway involved in phagocytosis
- innate immune response
- Fc-epsilon receptor signaling pathway
- receptor-mediated endocytosis
- regulation of immune response
- defense response to bacterium
- phagocytosis, engulfment
- B cell receptor signaling pathway
- complement activation, classical pathway
- immune response
- phagocytosis, recognition
- complement activation
- positive regulation of B cell activation
Components - external side of plasma membrane
- blood microparticle
- extracellular region
- immunoglobulin complex, circulating
- plasma membrane
- extracellular space
- extracellular exosome
|
|---|
| General Function | Immunoglobulin receptor binding |
|---|
| Specific Function | Not Available |
|---|
| Pfam Domain Function | |
|---|
| Transmembrane Regions | Not Available |
|---|
| GenBank Protein ID | Not Available |
|---|
| UniProtKB ID | P0CG04 |
|---|
| UniProtKB Entry Name | LAC1_HUMAN |
|---|
| Cellular Location | Not Available |
|---|
| Gene sequence | Not Available |
|---|
| GenBank Gene ID | Not Available |
|---|
| GeneCard ID | Not Available |
|---|
| GenAtlas ID | Not Available |
|---|
| HGNC ID | HGNC:5855 |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | Not Available |
|---|
| References | - Fett JW, Deutsch HF: Primary structure of the Mcg lambda chain. Biochemistry. 1974 Sep 24;13(20):4102-14. 4415202
- Vasicek TJ, Leder P: Structure and expression of the human immunoglobulin lambda genes. J Exp Med. 1990 Aug 1;172(2):609-20. 2115572
- Hieter PA, Hollis GF, Korsmeyer SJ, Waldmann TA, Leder P: Clustered arrangement of immunoglobulin lambda constant region genes in man. Nature. 1981 Dec 10;294(5841):536-40. 6273747
- Azkargorta M, Soria J, Ojeda C, Guzman F, Acera A, Iloro I, Suarez T, Elortza F: Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification. J Proteome Res. 2015 Jun 5;14(6):2649-58. doi: 10.1021/acs.jproteome.5b00179. Epub 2015 May 20. 25946035
- Ely KR, Herron JN, Harker M, Edmundson AB: Three-dimensional structure of a light chain dimer crystallized in water. Conformational flexibility of a molecule in two crystal forms. J Mol Biol. 1989 Dec 5;210(3):601-15. 2515285
|
|---|
