NameTrypsin-2
Synonyms
  • 3.4.21.4
  • Anionic trypsinogen
  • Serine protease 2
  • TRY2
  • TRYP2
  • Trypsin II
Gene NamePRSS2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0017464|Trypsin-2
MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVIN
SRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKIT
NNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIK
DTIAANS
Number of residues247
Molecular Weight26487.55
Theoretical pINot Available
GO Classification
Functions
  • calcium ion binding
  • serine-type endopeptidase activity
Processes
  • collagen catabolic process
  • extracellular matrix disassembly
  • extracellular matrix organization
  • positive regulation of cell growth
  • positive regulation of cell adhesion
  • proteolysis
  • digestion
  • innate immune response
Components
  • extracellular matrix
  • extracellular region
  • extracellular space
General FunctionSerine-type endopeptidase activity
Specific FunctionIn the ileum, may be involved in defensin processing, including DEFA5.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP07478
UniProtKB Entry NameTRY2_HUMAN
Cellular LocationSecreted
Gene sequenceNot Available
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9483
Chromosome LocationNot Available
LocusNot Available
References
  1. Emi M, Nakamura Y, Ogawa M, Yamamoto T, Nishide T, Mori T, Matsubara K: Cloning, characterization and nucleotide sequences of two cDNAs encoding human pancreatic trypsinogens. Gene. 1986;41(2-3):305-10. 3011602
  2. Kimland M, Russick C, Marks WH, Borgstrom A: Immunoreactive anionic and cationic trypsin in human serum. Clin Chim Acta. 1989 Sep 15;184(1):31-46. 2598466
  3. Ghosh D, Porter E, Shen B, Lee SK, Wilk D, Drazba J, Yadav SP, Crabb JW, Ganz T, Bevins CL: Paneth cell trypsin is the processing enzyme for human defensin-5. Nat Immunol. 2002 Jun;3(6):583-90. Epub 2002 May 20. 12021776
  4. Sahin-Toth M, Kukor Z, Nemoda Z: Human cationic trypsinogen is sulfated on Tyr154. FEBS J. 2006 Nov;273(22):5044-50. 17087724
  5. Szabo A, Salameh MA, Ludwig M, Radisky ES, Sahin-Toth M: Tyrosine sulfation of human trypsin steers S2' subsite selectivity towards basic amino acids. PLoS One. 2014 Jul 10;9(7):e102063. doi: 10.1371/journal.pone.0102063. eCollection 2014. 25010489
  6. Ronai Z, Witt H, Rickards O, Destro-Bisol G, Bradbury AR, Sahin-Toth M: A common African polymorphism abolishes tyrosine sulfation of human anionic trypsinogen (PRSS2). Biochem J. 2009 Feb 15;418(1):155-61. doi: 10.1042/BJ20081848. 18986305