NameFibroblast growth factor 1
Synonyms
  • Acidic fibroblast growth factor
  • aFGF
  • ECGF
  • Endothelial cell growth factor
  • FGF-1
  • FGFA
  • HBGF-1
  • Heparin-binding growth factor 1
Gene NameFGF1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0001374|Fibroblast growth factor 1
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Number of residues155
Molecular Weight17459.58
Theoretical pI7.04
GO Classification
Functions
  • fibroblast growth factor receptor binding
  • heparin binding
  • growth factor activity
  • S100 protein binding
Processes
  • axon guidance
  • organ induction
  • angiogenesis
  • epidermal growth factor receptor signaling pathway
  • positive regulation of MAP kinase activity
  • innate immune response
  • branch elongation involved in ureteric bud branching
  • positive regulation of epithelial cell proliferation
  • Fc-epsilon receptor signaling pathway
  • mesonephric epithelium development
  • anatomical structure morphogenesis
  • positive regulation of cell migration
  • phosphatidylinositol-mediated signaling
  • lung development
  • positive regulation of ERK1 and ERK2 cascade
  • activation of MAPKK activity
  • positive regulation of angiogenesis
  • fibroblast growth factor receptor signaling pathway
  • insulin receptor signaling pathway
  • positive regulation of cell division
  • MAPK cascade
  • signal transduction
  • regulation of endothelial cell chemotaxis to fibroblast growth factor
  • neurotrophin TRK receptor signaling pathway
  • positive regulation of transcription from RNA polymerase II promoter
  • positive regulation of cholesterol biosynthetic process
  • Ras protein signal transduction
  • cellular response to heat
  • vascular endothelial growth factor receptor signaling pathway
  • small GTPase mediated signal transduction
  • multicellular organismal development
  • positive regulation of intracellular signal transduction
  • positive regulation of cell proliferation
Components
  • proteinaceous extracellular matrix
  • extracellular region
  • cell cortex
  • extracellular space
  • cytosol
  • nucleoplasm
General FunctionS100 protein binding
Specific FunctionPlays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID181942
UniProtKB IDP05230
UniProtKB Entry NameFGF1_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0021840|Fibroblast growth factor 1 (FGF1)
ATGGCTGAAGGGGAAATCACCACCTTCACAGCCCTGACCGAGAAGTTTAATCTGCCTCCA
GGGAATTACAAGAAGCCCAAACTCCTCTACTGTAGCAACGGGGGCCACTTCCTGAGGATC
CTTCCGGATGGCACAGTGGATGGGACAAGGGACAGGAGCGACCAGCACATTCAGCTGCAG
CTCAGTGCGGAAAGCGTGGGGGAGGTGTATATAAAGAGTACCGAGACTGGCCAGTACTTG
GCCATGGACACCGACGGGCTTTTATACGGCTCACAGACACCAAATGAGGAATGTTTGTTC
CTGGAAAGGCTGGAGGAGAACCATTACAACACCTATATATCCAAGAAGCATGCAGAGAAG
AATTGGTTTGTTGGCCTCAAGAAGAATGGGAGCTGCAAACGCGGTCCTCGGACTCACTAT
GGCCAGAAAGCAATCTTGTTTCTCCCCCTGCCAGTCTCTTCTGATTAA
GenBank Gene IDM13361
GeneCard IDNot Available
GenAtlas IDFGF1
HGNC IDHGNC:3665
Chromosome Location5
Locus5q31
References
  1. Jaye M, Howk R, Burgess W, Ricca GA, Chiu IM, Ravera MW, O'Brien SJ, Modi WS, Maciag T, Drohan WN: Human endothelial cell growth factor: cloning, nucleotide sequence, and chromosome localization. Science. 1986 Aug 1;233(4763):541-5. 3523756
  2. Mergia A, Tischer E, Graves D, Tumolo A, Miller J, Gospodarowicz D, Abraham JA, Shipley GD, Fiddes JC: Structural analysis of the gene for human acidic fibroblast growth factor. Biochem Biophys Res Commun. 1989 Nov 15;164(3):1121-9. 2590193
  3. Wang WP, Lehtoma K, Varban ML, Krishnan I, Chiu IM: Cloning of the gene coding for human class 1 heparin-binding growth factor and its expression in fetal tissues. Mol Cell Biol. 1989 Jun;9(6):2387-95. 2474753
  4. Chiu IM, Wang WP, Lehtoma K: Alternative splicing generates two forms of mRNA coding for human heparin-binding growth factor 1. Oncogene. 1990 May;5(5):755-62. 1693186
  5. Wang WP, Quick D, Balcerzak SP, Needleman SW, Chiu IM: Cloning and sequence analysis of the human acidic fibroblast growth factor gene and its preservation in leukemia patients. Oncogene. 1991 Sep;6(9):1521-9. 1717925
  6. Yu YL, Kha H, Golden JA, Migchielsen AA, Goetzl EJ, Turck CW: An acidic fibroblast growth factor protein generated by alternate splicing acts like an antagonist. J Exp Med. 1992 Apr 1;175(4):1073-80. 1372643
  7. Zhao XM, Yeoh TK, Hiebert M, Frist WH, Miller GG: The expression of acidic fibroblast growth factor (heparin-binding growth factor-1) and cytokine genes in human cardiac allografts and T cells. Transplantation. 1993 Nov;56(5):1177-82. 7504343
  8. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  9. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. 15372022
  10. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  11. Crumley G, Dionne CA, Jaye M: The gene for human acidic fibroblast growth factor encodes two upstream exons alternatively spliced to the first coding exon. Biochem Biophys Res Commun. 1990 Aug 31;171(1):7-13. 2393407
  12. Harper JW, Strydom DJ, Lobb RR: Human class 1 heparin-binding growth factor: structure and homology to bovine acidic brain fibroblast growth factor. Biochemistry. 1986 Jul 15;25(14):4097-103. 2427112
  13. Gimenez-Gallego G, Conn G, Hatcher VB, Thomas KA: The complete amino acid sequence of human brain-derived acidic fibroblast growth factor. Biochem Biophys Res Commun. 1986 Jul 31;138(2):611-7. 3527167
  14. Gautschi-Sova P, Muller T, Bohlen P: Amino acid sequence of human acidic fibroblast growth factor. Biochem Biophys Res Commun. 1986 Nov 14;140(3):874-80. 3778488
  15. Gimenez-Gallego G, Conn G, Hatcher VB, Thomas KA: Human brain-derived acidic and basic fibroblast growth factors: amino terminal sequences and specific mitogenic activities. Biochem Biophys Res Commun. 1986 Mar 13;135(2):541-8. 3964259
  16. Gautschi P, Frater-Schroder M, Bohlen P: Partial molecular characterization of endothelial cell mitogens from human brain: acidic and basic fibroblast growth factors. FEBS Lett. 1986 Aug 18;204(2):203-7. 3732516
  17. Wu DQ, Kan MK, Sato GH, Okamoto T, Sato JD: Characterization and molecular cloning of a putative binding protein for heparin-binding growth factors. J Biol Chem. 1991 Sep 5;266(25):16778-85. 1885605
  18. Ornitz DM, Xu J, Colvin JS, McEwen DG, MacArthur CA, Coulier F, Gao G, Goldfarb M: Receptor specificity of the fibroblast growth factor family. J Biol Chem. 1996 Jun 21;271(25):15292-7. 8663044
  19. Landriscina M, Bagala C, Mandinova A, Soldi R, Micucci I, Bellum S, Prudovsky I, Maciag T: Copper induces the assembly of a multiprotein aggregate implicated in the release of fibroblast growth factor 1 in response to stress. J Biol Chem. 2001 Jul 6;276(27):25549-57. Epub 2001 May 10. 11432880
  20. Skjerpen CS, Wesche J, Olsnes S: Identification of ribosome-binding protein p34 as an intracellular protein that binds acidic fibroblast growth factor. J Biol Chem. 2002 Jun 28;277(26):23864-71. Epub 2002 Apr 18. 11964394
  21. Zhang X, Ibrahimi OA, Olsen SK, Umemori H, Mohammadi M, Ornitz DM: Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family. J Biol Chem. 2006 Jun 9;281(23):15694-700. Epub 2006 Apr 4. 16597617
  22. Di Serio C, Doria L, Pellerito S, Prudovsky I, Micucci I, Massi D, Landriscina M, Marchionni N, Masotti G, Tarantini F: The release of fibroblast growth factor-1 from melanoma cells requires copper ions and is mediated by phosphatidylinositol 3-kinase/Akt intracellular signaling pathway. Cancer Lett. 2008 Aug 18;267(1):67-74. doi: 10.1016/j.canlet.2008.03.001. Epub 2008 Apr 8. 18400376
  23. Cao R, Yan B, Yang H, Zu X, Wen G, Zhong J: Effect of human S100A13 gene silencing on FGF-1 transportation in human endothelial cells. J Formos Med Assoc. 2010 Sep;109(9):632-40. doi: 10.1016/S0929-6646(10)60103-9. 20863990
  24. Eswarakumar VP, Lax I, Schlessinger J: Cellular signaling by fibroblast growth factor receptors. Cytokine Growth Factor Rev. 2005 Apr;16(2):139-49. Epub 2005 Feb 1. 15863030
  25. Turner N, Grose R: Fibroblast growth factor signalling: from development to cancer. Nat Rev Cancer. 2010 Feb;10(2):116-29. doi: 10.1038/nrc2780. 20094046
  26. Zhen Y, Sorensen V, Skjerpen CS, Haugsten EM, Jin Y, Walchli S, Olsnes S, Wiedlocha A: Nuclear import of exogenous FGF1 requires the ER-protein LRRC59 and the importins Kpnalpha1 and Kpnbeta1. Traffic. 2012 May;13(5):650-64. doi: 10.1111/j.1600-0854.2012.01341.x. Epub 2012 Mar 4. 22321063
  27. Zhu X, Komiya H, Chirino A, Faham S, Fox GM, Arakawa T, Hsu BT, Rees DC: Three-dimensional structures of acidic and basic fibroblast growth factors. Science. 1991 Jan 4;251(4989):90-3. 1702556
  28. Blaber M, DiSalvo J, Thomas KA: X-ray crystal structure of human acidic fibroblast growth factor. Biochemistry. 1996 Feb 20;35(7):2086-94. 8652550
  29. DiGabriele AD, Lax I, Chen DI, Svahn CM, Jaye M, Schlessinger J, Hendrickson WA: Structure of a heparin-linked biologically active dimer of fibroblast growth factor. Nature. 1998 Jun 25;393(6687):812-7. 9655399
  30. Plotnikov AN, Hubbard SR, Schlessinger J, Mohammadi M: Crystal structures of two FGF-FGFR complexes reveal the determinants of ligand-receptor specificity. Cell. 2000 May 12;101(4):413-24. 10830168
  31. Pellegrini L, Burke DF, von Delft F, Mulloy B, Blundell TL: Crystal structure of fibroblast growth factor receptor ectodomain bound to ligand and heparin. Nature. 2000 Oct 26;407(6807):1029-34. 11069186
  32. Stauber DJ, DiGabriele AD, Hendrickson WA: Structural interactions of fibroblast growth factor receptor with its ligands. Proc Natl Acad Sci U S A. 2000 Jan 4;97(1):49-54. 10618369
  33. Kim J, Blaber SI, Blaber M: Alternative type I and I' turn conformations in the beta8/beta9 beta-hairpin of human acidic fibroblast growth factor. Protein Sci. 2002 Mar;11(3):459-66. 11847269
  34. Olsen SK, Ibrahimi OA, Raucci A, Zhang F, Eliseenkova AV, Yayon A, Basilico C, Linhardt RJ, Schlessinger J, Mohammadi M: Insights into the molecular basis for fibroblast growth factor receptor autoinhibition and ligand-binding promiscuity. Proc Natl Acad Sci U S A. 2004 Jan 27;101(4):935-40. Epub 2004 Jan 19. 14732692
  35. Pineda-Lucena A, Jimenez MA, Nieto JL, Santoro J, Rico M, Gimenez-Gallego G: 1H-NMR assignment and solution structure of human acidic fibroblast growth factor activated by inositol hexasulfate. J Mol Biol. 1994 Sep 9;242(1):81-98. 7521397
  36. Pineda-Lucena A, Jimenez MA, Lozano RM, Nieto JL, Santoro J, Rico M, Gimenez-Gallego G: Three-dimensional structure of acidic fibroblast growth factor in solution: effects of binding to a heparin functional analog. J Mol Biol. 1996 Nov 22;264(1):162-78. 8950275
  37. Lozano RM, Jimenez M, Santoro J, Rico M, Gimenez-Gallego G: Solution structure of acidic fibroblast growth factor bound to 1,3, 6-naphthalenetrisulfonate: a minimal model for the anti-tumoral action of suramins and suradistas. J Mol Biol. 1998 Sep 4;281(5):899-915. 9719643
  38. Fernandez IS, Cuevas P, Angulo J, Lopez-Navajas P, Canales-Mayordomo A, Gonzalez-Corrochano R, Lozano RM, Valverde S, Jimenez-Barbero J, Romero A, Gimenez-Gallego G: Gentisic acid, a compound associated with plant defense and a metabolite of aspirin, heads a new class of in vivo fibroblast growth factor inhibitors. J Biol Chem. 2010 Apr 9;285(15):11714-29. doi: 10.1074/jbc.M109.064618. Epub 2010 Feb 9. 20145243
  39. Mohan SK, Rani SG, Yu C: The heterohexameric complex structure, a component in the non-classical pathway for fibroblast growth factor 1 (FGF1) secretion. J Biol Chem. 2010 May 14;285(20):15464-75. doi: 10.1074/jbc.M109.066357. Epub 2010 Mar 10. 20220137